PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00134916001
Common NameGSBRNA2T00134916001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 336aa    MW: 37324.3 Da    PI: 5.6531
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00134916001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.92e-3971061100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +C+aCk+lrrkC+++Cv+ap+fp +qp+kf +vhk FGasnv kll++lp ++reda++slvyeAe r++dPvyG+vg+i+  qq+l+q 
  GSBRNA2T00134916001   7 PCSACKFLRRKCTRECVFAPHFPPDQPNKFSCVHKAFGASNVAKLLSELPLNQREDAVTSLVYEAETRIQDPVYGCVGLISLQQQRLKQI 96 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          + +++++++e
  GSBRNA2T00134916001  97 QRDTDVARRE 106
                          **99988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9066107IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-397104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MASSNSPCSA CKFLRRKCTR ECVFAPHFPP DQPNKFSCVH KAFGASNVAK LLSELPLNQR  60
EDAVTSLVYE AETRIQDPVY GCVGLISLQQ QRLKQIQRDT DVARRELATY IGPEAMFPIL  120
QPQQPHFMPQ SQTQQPQFVP ETQQTVFMPQ TQETHFTPQT HQSQFIPQTQ KFMPETQQPS  180
SSSSVSAELT QQQHHDPSMM VIPTAQLYHQ QQQQQFFEFQ QPEAVAGEQH SEMLRAYGEG  240
GSSSSHQHHL NQPQAHVLRF NDGFDSVPTG SVTSTGFNQL TPSGTTVTGV SHSLALGGGT  300
YDIEAQLFMP TQSSQQLPLQ TQETQTSSES DEEGS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00134916001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013611366.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ38e-99LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A078CWX80.0A0A078CWX8_BRANA; BnaC09g07710D protein
STRINGBra037142.1-P1e-171(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80082441
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-92ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]